General Information

  • ID:  hor006686
  • Uniprot ID:  Q92106
  • Protein name:  GnRH-associated peptide 3
  • Gene name:  gnrh3
  • Organism:  Rutilus rutilus (Roach)
  • Family:  GnRH family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Rutilus (genus), Leuciscinae (subfamily), Leuciscidae (family), Cyprinoidei (suborder), Cypriniformes (order), Cypriniphysae (superorder), Otophysi, Ostariophysi (subcohort), Otomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  SVGEVEATIRMMDGGDTLLSIPADTPMEQLSPIHIMNEVDAEGFPLKEQRFPNRRGRM
  • Length:  58
  • Propeptide:  MEWKGRVLVQLLMLVCVLEVSLCQHWSYGWLPGGKRSVGEVEATIRMMDGGDTLLSIPADTPMEQLSPIHIMNEVDAEGFPLKEQRFPNRRGRM
  • Signal peptide:  MEWKGRVLVQLLMLVCVLEVSLC
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates the secretion of gonadotropins.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q92106-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006686_AF2.pdbhor006686_ESM.pdb

Physical Information

Mass: 750228 Formula: C277H450N80O89S5
Absent amino acids: CWY Common amino acids: EGMPR
pI: 4.42 Basic residues: 7
Polar residues: 13 Hydrophobic residues: 16
Hydrophobicity: -46.21 Boman Index: -12350
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 73.97
Instability Index: 3849.14 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  9460654
  • Title:  Isolation and characterisation of mRNA encoding the salmon- and chicken-II type gonadotrophin-releasing hormones in the teleost fish Rutilus rutilus (Cyprinidae).